SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012408 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000012408
Domain Number - Region: 36-91
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.0235
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012408   Gene: ENSTTRG00000013078   Transcript: ENSTTRT00000013078
Sequence length 306
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2495:207744:216309:1 gene:ENSTTRG00000013078 transcript:ENSTTRT00000013078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPEWLLLLFGPWLLRKAVSAQIPESGRPQYLELGPATAGEGAPGHRLPAPPRSSDGL
GTARAWSWAWPANHTRTLARAGVAGAPVQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKF
SLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPAPHPLQSTL
ALEGVLPGLGPPLGLAAAGSGLGGTLGGALAGPLGGALGVPGTKESRAFNCHVEYEKTNR
ARKHRPCLYDPSQVCFTEHTQSQAAWLCAKLFKVICIFVSFLSFDYKLVQKVCPDYNFQS
EHPYFG
Download sequence
Identical sequences ENSTTRP00000012408 ENSTTRP00000012408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]