SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012494 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012494
Domain Number 1 Region: 332-509,544-710
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.16e-83
Family YicI catalytic domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 1206-1397,1442-1603
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.6e-70
Family YicI catalytic domain-like 0.00029
Further Details:      
 
Domain Number 3 Region: 88-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.53e-50
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 955-1202
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.07e-35
Family YicI N-terminal domain-like 0.0072
Further Details:      
 
Domain Number 5 Region: 713-793
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.87e-16
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 6 Region: 927-979
Classification Level Classification E-value
Superfamily Trefoil 0.0000000434
Family Trefoil 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012494
Domain Number - Region: 1639-1681
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0669
Family alpha-Amylases, C-terminal beta-sheet domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012494   Gene: ENSTTRG00000013161   Transcript: ENSTTRT00000013166
Sequence length 1821
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_433:224843:332209:-1 gene:ENSTTRG00000013161 transcript:ENSTTRT00000013166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFTGLEISLIVLFAIVTIIAIALIAVLATKTPAVEEVSGSTSTPATIHTTTVYPGS
GKCPSVLNDLINERINCIPEQFPTQTLCAARGCCWRPWNNSVIPWCFFVDNHGYNAEGTT
STNTGLEAKLNRIPSPTLFGNDINTVLLTTQSQTPKRFRFKITDPNNRRYEVPHQFVKEF
SGTAASDTLYDVKVIDNPFSIKVYRKSNDRLLFDTSIGPLVYSDQYLQISARLSSEYIYG
IGEHIHKRFRHDLYWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYIFLGDTPEQVVQQYQELIGRPTMPAYWSLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPEFVQDLHDHGQ
KYVIILDPAISIEKRANGAAYETYERGTAQNVWVNESDGTTAIIGEVWPGLTVYPDFTNP
NCIEWWANECSIFHQQVNYDGLWIDMNEVSSFIHGSKKGCSDNKLNYPAFTPDILDKILY
SKTICMDAVQHWGKQYDVHSLYGYSMAIATEKALQKVFPNKRSFILSRSTFAGSGSYAAH
WLGDNTASWEQMEWSITGMLEFGLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSR
NHNADGYEHQDPAFFGPNSLLVNSSRHYLNIRYTLLPFLYTLFYKAHMFGETVARPFLHE
FYEDTNSWIEDTQFLWGPSLLITPVLKQGADTVSAYIPNATWYDFETGAKRPWKGQRVDM
YLPADKIGLHLRGGYIIPIQQPAVTTTASRNNPLGLIVALDEDNKAKGDFFWDDGETKDT
IQNGNYILYTFSVSNNKLDIICTHSSYQEGTTLAFETIKILGLIDTVTEVSVMEDNQPMR
AHYNFTYDTSNQNLLIYNLMFNLGRNFTVQWDQTFLEAEKFTCYPDADIATKQRCEERGC
LWETAPLGSKAPECYFPKEDNSYLVQSTHYSSVGITADLQLNTVKARIKLPSDPIPTLHV
EVKYHKDDMLQFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPFGIQIRRRS
TGRIIWDSRLPGFAFNNQFIQISTRLPSEYIYGFGETEHTAFKRDLNWHTWGMFTRDQPP
GYKLNSYGFHPYYMALEDKSHAHGVLLLNSNAMDVTFQPTPALTYRITGGILDFYMFLGP
SPEVATKQYHRVIGQPVMPPYWALGFQLCLSGYRNTSQVEEVYNDMVAAQIPYDVQYTDI
DYMERQLDFTIDEEFRDLPQFVDKIRSEGMRYIIVLDPAISGNETKPYPAFERGQEKDVF
VKWPNTNDICWAKVWPGLPNVTKDESLIDEAVNGSRAHVAFPDFFRNSTAEWWTREIIDF
YNNQMKFDGLWIDMNEPSSFVNGTTTNQCRNTELNYPPYFPXXXXXXXXXXXXXXXMETE
QILSDGSSVLHYDVHNLYGWSQAKLTYDALQKATGKRGIVISRSTYPTAGRWVGHWLGDS
YAKWDNLDKSIIGMMEFSLFGMSYTGADICGFFNNSEYQLCARWMQLGAFYPNARNHNTA
FTGRKHPASWNATFSEMSRNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHFNKPTWDI
FQFLWSAFXXXXXXXXYADTVEGYVPNARWFDYHTGKDIGVREKFHTFAAPLYEINLHVR
GGYILPCQEAAQNTFYSRKNYMKLIVAADDNQMAQGSLFWDDGETIDTYERDLYFFVQFN
LNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
LNIDLRQNNVTLDEPIEINWS
Download sequence
Identical sequences ENSTTRP00000012494 ENSTTRP00000012494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]