SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012537 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012537
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 1.61e-18
Family DNA polymerase processivity factor 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012537   Gene: ENSTTRG00000013208   Transcript: ENSTTRT00000013215
Sequence length 390
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2747:15644:21464:1 gene:ENSTTRG00000013208 transcript:ENSTTRT00000013215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGSNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDPLRCKILMKSFLSVFRSLVILEKTVEKCCISLNVRSSRLVVQLYCKYGVRK
THNLSFQDCESLQAVFDPAVCPHVLCAPARVLGEAVLPFPPALAEVTLGIGRGHRIILRS
YQEEADSTIKAMVTEMSIGGEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLSLSIYFD
GPGRPAIFAIKDSLLDGHFVLATLSEPDPHPQDLRAPELQQPAPQLQAHSTPHLDDFALD
DIDSYMIAMETTVGSEGSRTLPSTSLSPGFQPHCSPGSHSEEEDDTEPSTVPGTPPPKKF
RSLFFGSILAPAHSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences ENSTTRP00000012537 ENSTTRP00000012537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]