SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012570 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012570
Domain Number 1 Region: 228-364
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-31
Family Voltage-gated potassium channels 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012570   Gene: ENSTTRG00000013248   Transcript: ENSTTRT00000013250
Sequence length 673
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_781:52791:406100:1 gene:ENSTTRG00000013248 transcript:ENSTTRT00000013250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATSPPRAERKRWGGGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPPGAP
GPASPTAPAAPPAAADLGPRPPVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWKC
FVYHFAVFLIVLVCLIFSVLSTIEQYVALATGTLFWMXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVD
RQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADA
LWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQK
HFNRQIPAAASLIQTAWRCYAAENPNSSTWKIYVRKPPRSHALLSPSPKPKKSAMVKKKK
FKLDNDNGVSPGERMLTVPHITCDPTSEERRPEHFSVDGYDSSVKKSPTLLEVSTAHFTR
TNSFAEDLDLEGETLLAPITHVSQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDV
IEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQ
LDQRLALITDMLHQLLAQHHGGSPGSRPSSGGGAQVVQPHSGGSINPELFLPSNALPTYE
QLTVPRGGPDKGS
Download sequence
Identical sequences ENSTTRP00000012570 ENSTTRP00000012570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]