SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012822 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012822
Domain Number 1 Region: 504-690
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 349-401,440-536
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-30
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 38-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012822   Gene: ENSTTRG00000013515   Transcript: ENSTTRT00000013514
Sequence length 984
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_151:444030:836734:-1 gene:ENSTTRG00000013515 transcript:ENSTTRT00000013514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRKGLVAPQNTFLENVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVM
QKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQD
KVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKH
SRLAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLNFHTTFPAGEVISDPKLIRMNYLRTWFVIDLLSC
PYDVINAFENVDEVSAFMGDPGKIGFADQIPPLLEGRESQGISSLFSSLKVVRLLRLGRV
ARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAM
DIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIM
MIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTW
SMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAP
GDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRAL
TYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRK
NEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGSILTEHTHHGLVKAS
VVTVRESPATPVAFPAAAASTGLDHARLQAPPGADCLGPKAGGGDWAKRKGWARFKDSCG
KAEDWSKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDSVGEARSPQDRSP
ILAEVKHSFYPIPEQTLQATVLEVKHELKEDIKALNTKMTNIENQLSEILRILTSRRSSQ
SPQELFEISRPQSPESERDIFGAS
Download sequence
Identical sequences ENSTTRP00000012822 ENSTTRP00000012822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]