SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012888 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012888
Domain Number 1 Region: 194-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-19
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 21-48,91-157
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000128
Family Voltage-gated potassium channels 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012888   Gene: ENSTTRG00000013581   Transcript: ENSTTRT00000013581
Sequence length 407
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1586:404773:503685:1 gene:ENSTTRG00000013581 transcript:ENSTTRT00000013581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGCGCSCGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLA
NFSRRHNLSRDELRGFLRHYEEATEAGIRVDNVRLRWDFTGAFYFVGTVVSTIGFGMTTP
ATVEGKLFLIYDLVGWSSTILFFNLFLERVIAVIACIRKSFHQRQLQRRGALPQQSLKNP
GKGEADSAAGWKPSVVMVILCMASLLISCCASAMYTSVEGWSYFDALYFCFVAFSTIGFG
DLVSSQNARYASQGLYRFANFVFILMGVCCIYSLFNVISILIKQSVNWILRKMDGGCCQQ
CQRSLLQSRRNVVMPGTVQNRCDISIETDGVIESDTDGRRLSGEMISMKDFLAANKVSLA
ILQKQLSETANGCPHQTSTLSLDDEFSGGIGAFAVMNNRLAETSGDR
Download sequence
Identical sequences ENSTTRP00000012888 ENSTTRP00000012888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]