SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012979 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012979
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-33
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000124
Family Calbindin D9K 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012979   Gene: ENSTTRG00000013681   Transcript: ENSTTRT00000013680
Sequence length 211
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1429:85477:94590:-1 gene:ENSTTRG00000013681 transcript:ENSTTRT00000013680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLWNAVLTLLVTSLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKVYLKKEFEKHGAVVNESHH
DVLVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences XP_004265729.1.21590 XP_004330535.1.83887 ENSTTRP00000012979 ENSTTRP00000012979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]