SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013050 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013050
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily UBC-like 2.46e-42
Family UEV domain 0.000000239
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013050
Domain Number - Region: 237-313
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0366
Family FCH domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013050   Gene: ENSTTRG00000013758   Transcript: ENSTTRT00000013758
Sequence length 391
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_786:166303:220713:-1 gene:ENSTTRG00000013758 transcript:ENSTTRT00000013758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSESQLKKMVSKYKYRDLTVRETVSVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGTTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGEEPPVFSRATISASYPPYQATGPPNTSSMPAMPSGISAYPSGYP
PNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLRKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSTTRP00000013050 ENSTTRP00000013050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]