SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013188 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013188
Domain Number 1 Region: 49-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.3e-26
Family 4HBT-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013188   Gene: ENSTTRG00000013916   Transcript: ENSTTRT00000013909
Sequence length 208
Comment pep:known_by_projection scaffold:turTru1:scaffold_106255:25600:28383:1 gene:ENSTTRG00000013916 transcript:ENSTTRT00000013909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLLMAVLALALAYFALLDGWYLVRVPCAVLRAHLLQPRVSDLLAEQSYSGRVLPSDLD
LLLHMNNARYLREADVARAAHLARCSVLGALRALGARAVLAASCARYRRSIHMLEPFEVR
TRLLGWDDRAFYLEARFISLRDGFVCALLRSRQHVLGTSPERVVQHLCKRRVEPPELPAD
LQHWIAYNEASSQLLRAESGLGSVVKDQ
Download sequence
Identical sequences ENSTTRP00000013188 ENSTTRP00000013188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]