SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013323 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013323
Domain Number 1 Region: 1054-1202,1240-1317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-36
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 2 Region: 1366-1608
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 128-281,336-406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-28
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 575-675
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000424
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013323   Gene: ENSTTRG00000014033   Transcript: ENSTTRT00000014050
Sequence length 1785
Comment pep:novel genescaffold:turTru1:GeneScaffold_3139:158429:235078:-1 gene:ENSTTRG00000014033 transcript:ENSTTRT00000014050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRCCPVIFPDARNFRPFTPDSLAAIKKRIAIQKEKKKSKDQTAAEPQPRPQLDLKVSR
NLPMLYGDIPHELIGKPLEDLDPFYRNHKTFMVLNKKRTIYRFSAKRALFILGPFNSIRS
LAIRISVHSLFSMFIICTVIINCVFMAMTRGKDSINIDTESAEYVFTGIYIFEALVKILA
RGFILDEFSFLRDPWNWLDSIVIATAFVSYSPYIKDSSISLSSLRTFRVFRALKAISVIS
XXXXXVGALLRSVKRLIDVMILTLFCLSIFALVGQQLFMGNLNQKCVRKDCDSDYKDYCF
EKKDSTEFRICGTWMESGACSEQFECKHTNKNPDYNYTNFDSFGWSFLAVFRLMTQDSWE
KLYQQTLRTSGLYSVFFFVVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAETEAKEKMFQ
EAQQRLKEEKEALVAMGIDRSSLNCLEASSFSLKKRKLFGNKKRKSFFLRKSGKDQVPGL
DSDEDSSKKAHLLEQTKRLSQNLSVEHCDEHRDPFQRQRALSAVSILTITMHEQEKSQEP
CLPCGENLASKYLVWDCSPRWLCIKKALRTMMTDPFTELAITICIIINTLFLAMEHYQMD
QSFENMLYTGNLVFTGIFMAEMCLKIIALDPYHYFHGGWNIFDSIVALLSFAEVIINSMC
PGKQSCMSLRSLRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXESPGEDKAQPITQPEAGNXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLDCCSPCCTMDKRKFPWIIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALVFEDIYLG
TQPKIQKILNCTDSIFTYIFILEMGLKWVAFGFRKYFTSAWCWLDFIIVIVSVTSLIDLK
VLKSFRILRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLIFCILGVNLFS
GKFGRCVNVTDGNSVINYNIVANRSQCESGNFSWFTLKVNFDNVGMAYLALLQVATFKGW
MDIMYAAVDSRGEGQQPRFEENSLMYVYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLG
GQDIFLTEEQKKYYNAMKKLGSKKPQRPIPRPLNKCQGLVFDLVTHQVFDIIIIILIFLN
MVSMMAESYGQSRAMELFLERLNLAFVAVFTTECLIKIFALRQYYFTSGWNLFDCVIVVI
SIVSTIVSALKTQAHIPFPPTFFRIVRLARIGRILRLVQAARGIRTLLFALMMSLPSLFN
IGLLLFLVMFIYAIFGMNCFCKVKEESGIDDIFNFKTFKGSMLCLFQITTSAGWDALLSP
MLQSKDSCNPKSENCYLSAIAITYFVSYIIISFLIVVNMYIAVILENFNIATEESEDPLG
EDDFEIFYEVWEKFDPEATQFIKYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSGDR
LHCLDILFAFTARVLGESSGLDSMKAVMEEKFMEANPFKKLYEPIVTTTKRKEEERSAAV
IQKAFRKYMMKTKCTLEDRPHSPLQTLCNGDLSSSGVAEGKVHYD
Download sequence
Identical sequences ENSTTRP00000013323 ENSTTRP00000013323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]