SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013454 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013454
Domain Number 1 Region: 14-476
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-167
Family ALDH-like 0.0000000000000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013454   Gene: ENSTTRG00000014188   Transcript: ENSTTRT00000014188
Sequence length 476
Comment pep:known_by_projection scaffold:turTru1:scaffold_105571:21661:69440:1 gene:ENSTTRG00000014188 transcript:ENSTTRT00000014188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSAMPDVPVPLTNLKFQYTKXXXXXEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDV
DKAVKAARQSFQIGSPWRTMDASERGRLINKLADLIERDRLLLATMESMNGGKLFSNAYL
MDLGGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRNEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHMTSLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTQVGKMIKEAAGKSNLKRVTLELGGKSPCIVFADADLDSAVAFAHHGVFYHQG
QCCIAASRLFVEESIYDEFVRKSVEQARKYVLGNPLTPGVNQGPIDKEQYEKILDLIESG
KKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRA
NNTFYGLSAGIFTKDIDKAITVSSALQAGTVWVNCYSVVSAQCPFGGFKMSGNGRE
Download sequence
Identical sequences ENSTTRP00000013454 ENSTTRP00000013454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]