SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013578 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013578
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.02e-121
Family Aldose 1-epimerase (mutarotase) 0.0000000000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013578   Gene: ENSTTRG00000014323   Transcript: ENSTTRT00000014322
Sequence length 342
Comment pep:known_by_projection scaffold:turTru1:scaffold_115774:109565:160191:1 gene:ENSTTRG00000014323 transcript:ENSTTRT00000014322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVTRAVFGDLPLGAGTVEKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDLVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYQLAINNGPNSLHGGVRGFDKVLWTP
QVLSNGVEFSRVSPDGEEGYPGELKVWVTYTLDGGELVINYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADTFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQEFHMN
GFDHNFCLKGSKEKRFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKRGALYPK
HSGFCLETQNWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSVA
Download sequence
Identical sequences ENSTTRP00000013578 ENSTTRP00000013578 XP_004316697.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]