SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013672 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013672
Domain Number 1 Region: 36-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.01e-49
Family Ribosomal protein S7 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013672   Gene: ENSTTRG00000014421   Transcript: ENSTTRT00000014418
Sequence length 243
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2630:114939:117569:1 gene:ENSTTRG00000014421 transcript:ENSTTRT00000014418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAVTAVRGWSGLLLGVRSVVLRLPGLTQVRWSRYGPEYQDPQIDKGYFRKPLAALTE
EEKYERELRKTQVIKAAPATRTSSVFEDPVISKFTNMMMKGGNKILARSLMTQTLEAVKR
KQFEKYHTASAEEQATIERNPYTIFHQALKNCEPVIGLVSILKGGHFYQVPVPLADQRRR
FLAMKWMITECREKKHRRMLMPEKLSQELLEAFHNRGPVIKRKHDMHKMAEANRALAHYR
WWW
Download sequence
Identical sequences ENSTTRP00000013672 ENSTTRP00000013672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]