SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013834 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013834
Domain Number 1 Region: 31-129
Classification Level Classification E-value
Superfamily POZ domain 2.94e-29
Family Tetramerization domain of potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013834   Gene: ENSTTRG00000014588   Transcript: ENSTTRT00000014588
Sequence length 257
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2051:212917:256052:-1 gene:ENSTTRG00000014588 transcript:ENSTTRT00000014588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLF
DGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPM
LLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVN
AGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELR
RTPRGPSVIRIKQEPLD
Download sequence
Identical sequences XP_004273780.1.21590 XP_006205149.1.17985 XP_007105460.1.24612 XP_007197637.1.59432 XP_007458459.1.90284 XP_011358699.1.92234 XP_016015563.1.101085 XP_016015564.1.101085 XP_019510114.1.44202 XP_019786030.1.83887 ENSSARP00000010843 ENSTTRP00000013834 ENSPVAP00000009398 ENSSARP00000010843 ENSTTRP00000013834 ENSPVAP00000009398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]