SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014144 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000014144
Domain Number - Region: 192-257
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00229
Family cAMP-binding domain 0.028
Further Details:      
 
Domain Number - Region: 247-281
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0471
Family ISY1 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014144   Gene: ENSTTRG00000014924   Transcript: ENSTTRT00000014918
Sequence length 360
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3439:168924:202751:-1 gene:ENSTTRG00000014924 transcript:ENSTTRT00000014918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYTKSSPLAESTAIGFTPELETILPVPSNETTCENWKEIHHLVFHVANIFFAIGLVIPT
TLHLHMILLRGMLTIGCTLYIVWATLYRCALDIMIWNSVFLGINILHLSYLLYKKRPVKI
ERLKLYHRLFESLRVLDLFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSIKGR
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKTVQKLDHQLSLCTQLSMLEMRNSIVSSS
EDEDGLHQFLRGTSSVSSLHVSPLHQRASAKMNPIEEGAENDDDVFEPVSSNTLQVRRWP
Download sequence
Identical sequences ENSTTRP00000014144 ENSTTRP00000014144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]