SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014165 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014165
Domain Number 1 Region: 237-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.34e-55
Family Decarboxylase 0.000000533
Further Details:      
 
Domain Number 2 Region: 11-205
Classification Level Classification E-value
Superfamily PRTase-like 1.56e-44
Family Phosphoribosyltransferases (PRTases) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014165   Gene: ENSTTRG00000014945   Transcript: ENSTTRT00000014941
Sequence length 480
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2188:585353:633154:1 gene:ENSTTRG00000014945 transcript:ENSTTRT00000014941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADDAALESLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRILSQVAEILFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGAINPGETCL
IIEDVVTSGSSVLETVEALQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDAEMVERVKRFIQENVFVTANRNGSFPSVKKGPKELSFGARAELPGIHPVA
SKLLRLMQKKETNLCLSADISESRELLQLADALGPRICMLKTHVDILNDFTLDVMKELTI
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLGEVGLP
LHRACLLIAEMSSAGSLATGSYTEAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGITTSANRLDAAEMYRKAAWEAYLSRLAL
Download sequence
Identical sequences ENSTTRP00000014165 ENSTTRP00000014165 XP_019778716.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]