SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014173 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014173
Domain Number 1 Region: 116-364
Classification Level Classification E-value
Superfamily vWA-like 3.56e-66
Family Integrin A (or I) domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 360-449
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-29
Family Integrin domains 0.0000954
Further Details:      
 
Domain Number 3 Region: 616-698
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000667
Family Integrin beta tail domain 0.00065
Further Details:      
 
Domain Number 4 Region: 9-61
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000889
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 575-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 532-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014173
Domain Number - Region: 501-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0206
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014173   Gene: ENSTTRG00000014948   Transcript: ENSTTRT00000014950
Sequence length 782
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2188:645486:757264:-1 gene:ENSTTRG00000014948 transcript:ENSTTRT00000014950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPRLPGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSLRSVTSRCDFKANLVRNGCGG
EFESPVSSTQVLRSLPLSSKGSSPAGSDVIQMTPQEVTVNLRPGDKTTFQLQVRQVEDYP
VDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKNISPFSYTAPRY
QTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAA
VCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEDNEYTASNQMXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFTALIPGTTVEILHGNSKNIIQLIINAYNS
IRSKVELSVWDQPEDINLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCPGKH
AQPMFTLRPVGFRDSLEVGVTYDCRCSCSTGLEPDSARCSGNGTYVCGLCECNPSYLGTR
CECQEGESQSGYQNLCREAEGKPLCSGRGQCSCNQCACFESEFGKIYGPFCECDNFSCAR
NKGVLCSGHGDCHCGECKCHAGYIGDNCNCSTDISTCQARDGQICSDRGHCVCGQCQCTE
PGAFGETCEKCPTCLDACSTKRDMGECLLAHSGSSADNQTLRLCKDEVITRVGLIVKDDQ
EAVLCFYKTAKDCVMMFTYAELPSGKSNLTVLREPECGTAPNAMTILLAVVGSIILIGLA
LLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGT
VD
Download sequence
Identical sequences ENSTTRP00000014173 ENSTTRP00000014173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]