SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014295 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014295
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 1.21e-69
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000294
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-22
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014295   Gene: ENSTTRG00000015082   Transcript: ENSTTRT00000015080
Sequence length 388
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_235:65973:67139:-1 gene:ENSTTRG00000015082 transcript:ENSTTRT00000015080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKGIIPEEYVLTRLAEDPTEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPYTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGAAVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHSRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNNIFLVAPLIIYHVIDANSPLYDLAPCDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDPSLLDVLT
LARGPLRKRSVAVAKAKAKFSVSPESLS
Download sequence
Identical sequences ENSTTRP00000014295 ENSTTRP00000014295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]