SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014307 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014307
Domain Number 1 Region: 9-133
Classification Level Classification E-value
Superfamily DNA clamp 2.86e-16
Family DNA polymerase processivity factor 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014307   Gene: ENSTTRG00000015091   Transcript: ENSTTRT00000015092
Sequence length 420
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3286:83502:116239:1 gene:ENSTTRG00000015091 transcript:ENSTTRT00000015092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMSGSQVKVFGKAIQALSRISDELWVDPSEKGLALRSMNSCRSAYGCVLFSPVFFQ
HYQWSTSVKMNDGDTISNLNCKLGMKSILPIFRCLNSLERNVEKCKIFTRSDKCKVVIQF
FCRHGIKRIHNLCFQESQPLQVIFEKNMCSNTLVIQPRVLAEATVLFTSSQEEVTLAVTP
LNVCIKSSNEESMDLTNSVYSEMFVGPDEFDFYQIGVNTEITFCFKELKGMLTFSEATHA
PIAIHFDFPGKPMALSIDDMLLEANFILATLADEPSRASSPQSLCLSQKRKRSELIHSNS
EAGKNVTSKDAEYISRKAVPKRLYSETRTKVSSSENRGSPLTERANRDISEVPESSVSDT
EEVPGSSHLRKFSRMFFGAVSSDQQEHFNHPFHSLATASDSEEDVNNVCRKEDAKYFCII
Download sequence
Identical sequences ENSTTRP00000014307 ENSTTRP00000014307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]