SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014323 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014323
Domain Number 1 Region: 264-434
Classification Level Classification E-value
Superfamily ITPase-like 8.83e-18
Family YjjX-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014323   Gene: ENSTTRG00000015110   Transcript: ENSTTRT00000015108
Sequence length 438
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2361:24031:63615:1 gene:ENSTTRG00000015110 transcript:ENSTTRT00000015108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPSSAGLAVAATAAQPSSPPAPLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXQGPPTSGFSVGSAYDITRGHAGRAPQTPLMPSFSAPPVTXXXXXXXXXXX
XXXXXXXXXXXXXXITFPEQQEDPRIGRGQDEASAGGLWGFIKGVAGNPMVKSVLDKTKH
SVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVIGEAGQSSI
APQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXAQSLTPQDYSLRWSGLLVTVGEVLEKSLLNVSRTDWHMT
FTGMSRRQMIYSAAKAVA
Download sequence
Identical sequences ENSTTRP00000014323 ENSTTRP00000014323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]