SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014337 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014337
Domain Number 1 Region: 271-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-17
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000387
Further Details:      
 
Domain Number 2 Region: 920-966
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 120-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 14-88
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014337   Gene: ENSTTRG00000015113   Transcript: ENSTTRT00000015122
Sequence length 1438
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_378:53425:154928:1 gene:ENSTTRG00000015113 transcript:ENSTTRT00000015122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNPGMSIPRVNPSVNPSISPAHGAARSATLPPSNNNVVSTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPNRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDGKPLDSGLLHNSDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTPSSASASSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVA
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPAPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETERMDGAV
TTVAIKSEILPAALQTTTARPTSRLNXXXXXXXXXXXXXXXXXGSGDQVPWTNNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSGPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQTRQTLNRPPAAPNQLRLQQQRLQGQQQLIHQNRQAILNQFA
ANAPVGISMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFG
NNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEATLANR
NSMVNRGMTGNMGGQFGTGISPQMQQNVFQYPGSMLPGEANFSPSLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFSQAVQNQPTPAQPGVYNNMSITVSMAG
GNTNVQNMNPMMGQMXXXXXXXXXXXXXXXXXINDPALRHTGLYCNQLSSTDLLKTEADG
TQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
Download sequence
Identical sequences ENSTTRP00000014337 ENSTTRP00000014337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]