SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014365 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014365
Domain Number 1 Region: 600-860
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-81
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 266-368
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 3 Region: 484-585
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 373-475
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 153-256
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 6 Region: 85-157
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-16
Family Kringle modules 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014365   Gene: ENSTTRG00000015151   Transcript: ENSTTRT00000015152
Sequence length 861
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2347:201979:267568:-1 gene:ENSTTRG00000015151 transcript:ENSTTRT00000015152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFAVALIFGALPGVVSFDPVLSYPLGPQYPYYLPTQQRPQRTPLPRVPRPPAALRT
PRLQALHARHTPGPRAGDCPAGEPWVNVTDFGASCLRWAEVPPFLERSPPAGWAQLRGQS
HNFCRSPDGTGRPWCFYGNAHGKVDWGYCDCRHGSVRLHGGKNEFEGTVEVYANGVWGTV
CSSHWDDSDASVVCHQLQLGGKGVARQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIW
QGGTCPQKKAAAVTCSFSHGPAFPVLRLAGGSSAREGRVELYHAGQWGTVCDDQWDDADA
EVVCRQLGLSGIAKAWNQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKED
AGVSCTPLTDGVIRLAGGKGNHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGK
QASANHFEESTGPILLDDVNCSGKETSFLQCSRRPWERHDCSHREDVAVSCYPGRDGHRL
SLGFPIRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDATVICRQLGYKGPARARTMAY
FGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHGEDAGVICDYFDKKASGNSNKES
LLSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTA
AHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDSSDYDIALVRLQG
PEEQCARFSSHVLPACLPLRRERPRKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFC
EDRYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKD
SPGVYTKVSAFVPWIKSITKL
Download sequence
Identical sequences ENSTTRP00000014365 ENSTTRP00000014365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]