SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014369 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014369
Domain Number 1 Region: 282-502
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.16e-51
Family NadC C-terminal domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 5-129
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 6.28e-28
Family NadC N-terminal domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 130-203
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.35e-22
Family NadC C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014369   Gene: ENSTTRG00000015149   Transcript: ENSTTRT00000015156
Sequence length 546
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_63:89852:93309:-1 gene:ENSTTRG00000015149 transcript:ENSTTRT00000015156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDLQATMALGYWRADRAQEAAEFELFRRCPFGGAFALAAGLRDCVRFVRDFRLTDADVQ
FLASVLPPDTDPAFFQHLRALDCSGVTVRALPEGSLAFPSVPLLQVSGPLLVVQLLETPL
LCLVSYASLVATNAARLRLIAGPEKRLLELGLRRAQGPDGGLTASTYSYLGGFDGSSNML
AGQLRGVPVAGTLAHSFITSFSGTEVPPEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAVALALEELGYQAVYLR
LDSGDLLQQAQEARGVFRTVAAQFRVPWLESIPIAVSNNIDEQELARLSQKGSEVNVIGI
GTSVVTCPRQPSLGCVYKLVSVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGALLLDVL
QLAEEPPPQAGQELRVWPRGTQESCTVRPVHVEPLLRLWVQQGQLCEPLPSLAESRAFAQ
QSLSRMSPAHRWLEQPALYQVGGPHHQPAPALSPPTATHGPPLSSLQVALSEKLRALVDR
LSAEVL
Download sequence
Identical sequences ENSTTRP00000014369 ENSTTRP00000014369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]