SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014380 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014380
Domain Number 1 Region: 95-224
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.7e-32
Family Isochorismatase-like hydrolases 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014380   Gene: ENSTTRG00000015169   Transcript: ENSTTRT00000015168
Sequence length 231
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_859:136891:154682:1 gene:ENSTTRG00000015169 transcript:ENSTTRT00000015168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFVVQLFAEEWGQYVDLPKGFTVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQYPKGGSTVQEIDLTGVKLVLPKTKFSM
VLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRMF
ALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences ENSTTRP00000014380 ENSTTRP00000014380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]