SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014545 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014545
Domain Number 1 Region: 121-496
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.53e-143
Family alpha-mannosidase 0.00000000252
Further Details:      
 
Domain Number 2 Region: 615-1133
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.62e-128
Family alpha-mannosidase, C-terminal domain 0.00000288
Further Details:      
 
Domain Number 3 Region: 498-587
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.25e-26
Family alpha-mannosidase, domain 2 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014545   Gene: ENSTTRG00000015344   Transcript: ENSTTRT00000015347
Sequence length 1134
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_848:279325:440276:1 gene:ENSTTRG00000015344 transcript:ENSTTRT00000015347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRQFTVGSAIFCVVIFSLMLDRGHLDYPKSPRREGSFPQGQLSMLQEKIDHLERLLAE
NNEIISNIRDSVINLSESVEDGSKSSKGNFSQGAGSPLLPSKQLSLTVDPGDCLFASQSG
SQGSDVQMLDVYSLIPFDNPDGGVWKQGFDITYKADEWDTKPLQVFVVPHSHNDPGWLKT
FDDYFREKTQYIFNNMVIKLKEDPRRKFMWSEISYLSKWWETIDIQKKDAVKSLLENGQF
EIVTGGWVMPDEAAPHYFALIDQLIEGHQWLEKNLGVKPRSGWSIDPFGHSPTMAYLLKR
AGFSHMLIQRVHYAVKKHFALHKMLEFFWRQNWDLGSVTDIFCHMMPFYSYDIPHTCGPD
PKICCQFDFKRLPGGRYGCPWGVPPETIYLGNLQNRAEMLLDQYRKKSKLFRTTIVLAPL
GDDFRYCERTEWDHQFKNYQLLFDYMNSRSQYNVKIQFGTLSDYFDALDKEDAANRKNSQ
SMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRILESHLRAAEILYYFALKQAQQYK
ISKFLSSSHYMMLTEARRNLGLFQHHDAITGTAKDWVVVDYGTSLFHLGGGIEIFELLLI
LKDKRSYDSYSFDTFLEMDLKQRTQSSLPQKNVISLSAEPRYLVVYNPSEQDRNSVVSVC
VSSPTAQVSSASGKPVEIQMSAVWDTASTVSQAAYEISFLAQMPPLGLKVYKILETASSN
PHLAEYALYNGHIANKGIFNMNNIKSAQEDITLENSFIKLRFGHSGLMEEMINKGDGKSH
EVKVQFSWYGTTSKKDKSGAYLFLPDGEAKPYVYTTPPFVIVQHGRFFSDVTCFFEHVTH
RVRLYNIHGIEGQSVEISNIVDIRKEHNREIAMRISSSINNQNRFYTDLNGYQIQPRMTL
SKLPLQANVYPMTTMAYVQDAEYRLTLLSAQSLGVSSLKSGQIEVIMDRRLMQDDNRGLE
QGVHDNKITANLFRILLEKRSVMNMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLLGEFSMSSFPCDHLVNLRTIQSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXILVQKLFNKFTVVSLIPSSLSLMHSPPDARNISEINLSPMEISTFRIQLR
Download sequence
Identical sequences ENSTTRP00000014545 ENSTTRP00000014545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]