SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014564 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014564
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily DNA clamp 1.82e-47
Family DNA polymerase processivity factor 0.000000371
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily DNA clamp 0.0000000000534
Family DNA polymerase processivity factor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014564   Gene: ENSTTRG00000015368   Transcript: ENSTTRT00000015368
Sequence length 187
Comment pep:known_by_projection scaffold:turTru1:scaffold_110903:13889:17403:1 gene:ENSTTRG00000015368 transcript:ENSTTRT00000015368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYS
CVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEA
VTIDMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPK
IEDEEGS
Download sequence
Identical sequences ENSTTRP00000014564 ENSTTRP00000014564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]