SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014618 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014618
Domain Number 1 Region: 105-241
Classification Level Classification E-value
Superfamily dUTPase-like 6.02e-49
Family dUTPase-like 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014618   Gene: ENSTTRG00000015422   Transcript: ENSTTRT00000015425
Sequence length 246
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_275:147989:159758:1 gene:ENSTTRG00000015422 transcript:ENSTTRT00000015425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYLCPRPVLSYHFLPSLLRSVFNGARQARPRTEAAPSPGSSLDPPRDVLRARPLTSARS
LSRGCRSASNVGAGWKDTAWGGWVPGLKAQVISPSKRARPAEKGGMRLRFVRLSEHATAP
TKGSERAAGYDLYSAYDYTVPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFIYVGA
GVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGF
GSTGNN
Download sequence
Identical sequences ENSTTRP00000014618 ENSTTRP00000014618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]