SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014770 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014770
Domain Number 1 Region: 110-309
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.67e-59
Family Endonuclease III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014770   Gene: ENSTTRG00000015588   Transcript: ENSTTRT00000015589
Sequence length 312
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3086:26709:32454:-1 gene:ENSTTRG00000015588 transcript:ENSTTRT00000015589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCSPQESGMNAVGVRMVTRSRSRGPGAGQQGSREKPAPLRREEAAAEGRKSYSPVKRQRK
AQRLNVAYEASEGEKGEGVEHLQSPAWEPQDWRQQLENIRTMRSGKDAPVDQLGVEHCYD
LSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQMDDSTLGTLIYPVG
FWRNKVKYIKQTSAILQQRYDGDIPASLAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIVNRLRWTRKATKSPEETRRALEEWLPRELWSEINGLLVGFGQQTCLPLHPRCQAC
LNRALCPAAHGL
Download sequence
Identical sequences ENSTTRP00000014770 ENSTTRP00000014770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]