SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014877 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014877
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014877   Gene: ENSTTRG00000015700   Transcript: ENSTTRT00000015701
Sequence length 165
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1469:169439:173214:-1 gene:ENSTTRG00000015700 transcript:ENSTTRT00000015701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVSIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences L9KLN4
ENSDNOP00000006512 XP_004269247.1.21590 XP_004375744.1.4749 XP_004479817.2.11602 XP_005881523.1.60319 XP_006102158.1.53796 XP_006106282.1.53796 XP_006154149.1.99106 XP_007101823.1.24612 XP_007471788.1.90284 XP_008160242.1.99482 ENSTTRP00000014877 ENSTTRP00000014877 9361.ENSDNOP00000006512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]