SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014972 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014972
Domain Number 1 Region: 387-647
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-76
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 262-370
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-31
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 98-146
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-17
Family Fibronectin type II module 0.0017
Further Details:      
 
Domain Number 4 Region: 158-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000321
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014972
Domain Number - Region: 197-235
Classification Level Classification E-value
Superfamily FnI-like domain 0.00044
Family Fibronectin type I module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014972   Gene: ENSTTRG00000015799   Transcript: ENSTTRT00000015798
Sequence length 656
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2182:129600:137363:1 gene:ENSTTRG00000015799 transcript:ENSTTRT00000015798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVPSPCPPLGLSLLLLLLLLVPRGAQPQAGRNPTEPPECNATVTPGTPAIPVTSV
TPRTPATRTPGAEGPHGGGLTHLPRAAPSNSSPGGTVLTEAGQPCRFPFRYGGRMVHSCT
TEGSAHRKWCATTHNYDRDRAWGYCVQASTPREGPAALDPCASGPCLNGGSCSSTQDPES
YHCTCPVAFTGKDCGTGKCFDESRYEYLEVGDRWARVHRGQVEQCECAGGQVRCQGTRHT
ACLSSPCLNGGTCHLIVATGTTVCACPPDHAGRLCNIVPAQSCFVGSGTEYRGVASTAAS
GLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDKDEKPWCYVVKDSALSWEYCR
LAACGSLARIQPPPTEALLSLPGPAAAGPAGRQTCGKRHKKRSFLRPRIIGGSSSLPGSH
PWLAAIYIGNSFCAGSLVHTCWVVSAAHCFSNSPPRESVSVVLGQHFFNRTTAVTQTFGI
EKYIPYPLYSVFNPSDHDLVLIRLEKKGERCAVRSQFVQPICLPEPGSTFPAGHKCQIAG
WGHQDENVSGYSSLLREALVPLVADHKCSSPEVYGADVSPNMLCAGYFDCRSDACQGDSG
GPLACEKNGVAYLYGIISWGDGCGQFNKPGVYTRVTRYVDWISDRIRPPKRPVNPS
Download sequence
Identical sequences ENSTTRP00000014972 ENSTTRP00000014972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]