SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014979 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014979
Domain Number 1 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.44e-33
Family eIF2alpha middle domain-like 0.00000199
Further Details:      
 
Domain Number 2 Region: 226-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.31e-22
Family eIF-2-alpha, C-terminal domain 0.0000106
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.08e-18
Family Cold shock DNA-binding domain-like 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014979   Gene: ENSTTRG00000015806   Transcript: ENSTTRT00000015805
Sequence length 315
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3288:1005851:1020197:1 gene:ENSTTRG00000015806 transcript:ENSTTRT00000015805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVDDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDGLDLNEDEREVLINNI
NRRLTPQAVKIRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences ENSTTRP00000014979 ENSTTRP00000014979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]