SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015053 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015053
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 7.56e-70
Family Integrin A (or I) domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 1128-1312
Classification Level Classification E-value
Superfamily Fibronectin type III 2.24e-36
Family Fibronectin type III 0.00000374
Further Details:      
 
Domain Number 3 Region: 1520-1721
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 990-1111
Classification Level Classification E-value
Superfamily CalX-like 5.36e-20
Family CalX-beta domain 0.00066
Further Details:      
 
Domain Number 5 Region: 625-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000144
Family Integrin beta tail domain 0.0043
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000418
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015053
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 468-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015053   Gene: ENSTTRG00000015887   Transcript: ENSTTRT00000015887
Sequence length 1815
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2909:247396:274670:1 gene:ENSTTRG00000015887 transcript:ENSTTRT00000015887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPHPSWWTRLLLAALLSASFPGDMANRCKKAQVKSCTECIRVDRDCAYCTDEMFKERR
CNTQAELLAAGCRQESMVVMESSFEITEETQIDTTLHRSQVSPQGLRVRLRPGEERHFEM
QVFEPLESPMDLYILMDFSNSMSDDLDNLKKMGQDLAQVLRQLTSDYMIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDAPFSFKNVISLTEDVEEFRNKLKGERISGNLDAPEGGFDAIL
QTAVCTRHIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMRRNDEECHLDTTGTYTQYG
TQDYPSVPTLVRLLDRHNIIPIFAVTNYSYSYYEKLSSYFPVSSLGVLQEDSSNIVDLLQ
DAFNRIRSNLDIRALESPRGLRTEVTSRMFQKTNTGSFLIRRGEVGTYQVQLRAIEDLDG
THVCQLPEADRKGNIHLKPSFSNGLKMDVDIVCDVCSCELQKEERSPRCSFNGDFMCGHC
VCSEGWSGKTCNCSTGSLSDLAPCQREGEDKLCSGQGECQCGHCVCYGDGRYEGQFCEYD
NFQCPRASGFLCNDRGRCSMGQCVCEPGWTGLSCDCPLSNATCIDSNGGICNGRGYCECG
RCHCNQQSLYTDTICEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGHVCKECSFKVKMVD
ELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGGLGSNSTVLMKEKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXACLALLPCCNRGHMVGFKEDHYMLRANLMASDHLDTPLLR
SGNLKGRDTVRWKTTNNVQRPGFASHAAGINPTELAPYGLSLRLARLCTENLLKPGTREC
DQLRQEVEENLHEVYRHITGAQKLQQTKFRQQPNAGKKQDHTIVDMVLMAPRSAKQALLK
LTEKQVEQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQASGIVSFEQPEYLVSRGEHVARIPVIRRILDNG
KSQVSYCTEDNTAQGNRDYIPTEGELLFQPGETWKELQVKLLELQEMDSLLRGCQTRRFY
IQLSNPKFGARLGQPQSATVIIGDQDELDGTLMGQTLSSPLLPRGDLGAPQNPNAKATGS
RKIHFNWLPPPGKPTGYRVKYWIQGDSESEAHLLDSKMPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHPEAPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NEDSRPIGPMKKVLVDSPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYESFLMYSDDVLRSPTGSQRPSVSEDTGGSGWKFEPLL
GEELDLRRVTWQLPPELIPRLSASSRRSSDTAEPPRGPLDDGAADGGRGVPAGGEHLVNG
RMDFAFPGSANSLHRMAVSNAAYSTHLSPHLPHRVLSTSSTLSRDYHSLTRPEHSHSSTL
PRDYSTLTSLSSQSSRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCERALQGYSVEYQL
LNGGDLHQLNIPNPSQTSVVLEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQS
PLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGEP
ATTFLVDGDSPESRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQAGGPFPQLG
SHSGLFQYPMPGEYSITTTHSSTTEPVLLDGLTLGSQHLEAHGSLTRHVTQEFVSRTLTT
SGTLGTHVDQQFFQT
Download sequence
Identical sequences ENSTTRP00000015053 ENSTTRP00000015053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]