SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015054 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015054
Domain Number 1 Region: 138-286
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.98e-38
Family GHMP Kinase, N-terminal domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 291-368
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.92e-16
Family Galactokinase 0.0000487
Further Details:      
 
Domain Number 3 Region: 10-56
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000484
Family GHMP Kinase, N-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015054   Gene: ENSTTRG00000015888   Transcript: ENSTTRT00000015888
Sequence length 370
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2909:275133:281105:-1 gene:ENSTTRG00000015888 transcript:ENSTTRT00000015888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASEQRQPGELLAKARRAFLEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMWDGAF
HTLEGRKRGIREEVGWTADPRHLLGSTSDCGGMRNGPTVNRGEVALSLLVRPVQFAEEGA
WGHVHPMCITDPQPGAHAGRVQDGLISLLTTSEDADEPRRLQFPLPTTQRPLEPGAPHWA
NYVKGVIQHYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARA
RVCQRAEHSFAGVPCGIMDQLIALLGQKGHALLIDCRSLETSLVPLLDPKLAVLITNSNV
RHSLGSSEYPLRRRQCEEVARALGKESLREVQLEELEAGRELMSGEAFRRARHVVGEIQR
TADGAQVLCL
Download sequence
Identical sequences ENSTTRP00000015054 ENSTTRP00000015054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]