SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015072 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015072
Domain Number 1 Region: 235-401,699-917,972-1018
Classification Level Classification E-value
Superfamily Ras GEF 9.55e-114
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 383-468
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-18
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 113-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000373
Family cAMP-binding domain 0.00082
Further Details:      
 
Domain Number 4 Region: 609-688
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000031
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015072   Gene: ENSTTRG00000015904   Transcript: ENSTTRT00000015906
Sequence length 1495
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_765:11855:105002:1 gene:ENSTTRG00000015904 transcript:ENSTTRT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLS
DIYQATESEAGEMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTD
DDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNNGEELDSWSVILNGS
VEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEK
NMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLL
TYRTFLCSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENN
LEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEE
KRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKT
RISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFS
ATPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTTTPDQYSLCEVSVTPE
GVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVE
VATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKKFEEVINQETFWVASEILRETN
QLKRMKTIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
AKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSS
FLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATNTLPKNPGDRKPVKAD
TSPVAPRAGLQPKPPPQAPQPSQRPSPGLQLPAVPLYPSRKKVPLRDLPPFGINSPQALK
KILALSEEGSLERHKRPAEDTVSDASSRFSSPPTSPQSSPRKGYTLAPSGTVDNFSDSGH
SEISSRSSIVSNSSFDSLPVSLPDERRQRPSVGTVETSLAAGRPERRPAGEPDQCSLGXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLDQAQSRA
SWASSTGYWGEDSEGDTGTIKRRGGKDVSLEAESSSMMSASAEEAKPVAMAAHVAVPPSA
TKGLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEQVSAV
Download sequence
Identical sequences ENSTTRP00000015072 ENSTTRP00000015072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]