SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015250 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015250
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-77
Family Carbonic anhydrase 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015250   Gene: ENSTTRG00000016090   Transcript: ENSTTRT00000016091
Sequence length 256
Comment pep:known_by_projection scaffold:turTru1:scaffold_109891:167461:234043:-1 gene:ENSTTRG00000016090 transcript:ENSTTRT00000016091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVANDGHAIQVILK
SKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSID
EAVGKPRGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRD
YWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHAKGAELVEGCDGILGDNF
RPTQPLSDRVIRAAFQ
Download sequence
Identical sequences ENSTTRP00000015250 ENSTTRP00000015250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]