SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015276 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015276
Domain Number 1 Region: 251-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-44
Family Protein kinases, catalytic subunit 0.00000039
Further Details:      
 
Domain Number 2 Region: 112-239
Classification Level Classification E-value
Superfamily SH2 domain 2.31e-37
Family SH2 domain 0.00000725
Further Details:      
 
Domain Number 3 Region: 48-143
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-22
Family SH3-domain 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015276   Gene: ENSTTRG00000016119   Transcript: ENSTTRT00000016117
Sequence length 418
Comment pep:known_by_projection scaffold:turTru1:scaffold_92546:11397:19076:1 gene:ENSTTRG00000016119 transcript:ENSTTRT00000016117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVFCKKLEPGPKEDGGLEEDFRGYGAADCCGPAPTQGRPASSFAHIPNYNNFSPQPAS
PAFLNGGTIRGISGTGVTLFIALYDYEARTEDDLTFAKGEKFHILNNIEGDWWEARSLSS
GQTGYIPSNYVAPVDSIQAEEWYFGKIGRKDSERQLLSPGNPRGAFLIRESETTKGAYSL
SIRDWDQARGDHVKHYKIRKLDTGGYYITTRAQFYSVQELVQHYLEVNDGLCHLLTAACT
TVKPQTLGLAKDAWEISRSSIALERRLGTGCFGDVWLGMWNGSTKVAVKTLKPGTMSPKA
FLAEAQIMKLLRHDKLVQLYAVVSEEPIYIVTEFLCHGEGRGSLLEFLKDREGWDLRLPQ
LVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLLCKIADFGLARLIEDDEYNPHQ
Download sequence
Identical sequences ENSTTRP00000015276 ENSTTRP00000015276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]