SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015322 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015322
Domain Number 1 Region: 31-170
Classification Level Classification E-value
Superfamily Cupredoxins 1.03e-47
Family Ephrin ectodomain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015322   Gene: ENSTTRG00000016165   Transcript: ENSTTRT00000016165
Sequence length 238
Comment pep:novel scaffold:turTru1:scaffold_113064:48532:56171:-1 gene:ENSTTRG00000016165 transcript:ENSTTRT00000016165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRAGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
Download sequence
Identical sequences XP_004284678.1.21590 XP_004482859.1.11602 ENSTTRP00000015322 ENSTTRP00000015322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]