SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015349 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015349
Domain Number 1 Region: 224-290
Classification Level Classification E-value
Superfamily Homeodomain-like 5.13e-23
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015349
Domain Number - Region: 16-26
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015349   Gene: ENSTTRG00000016192   Transcript: ENSTTRT00000016192
Sequence length 357
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3267:95046:96715:1 gene:ENSTTRG00000016192 transcript:ENSTTRT00000016192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPGPDAPGTASAQPPPPPPPPPAPKESPFSIKNLLNGDHHRPPPKPQPPPRTLFAPAS
AAAAAAAAAAAAAKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPY
TLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPEPLLKADPDHKELDSKSPDEIILEES
DSEEGKKEGEAAPGAAGANVGAAAATPGAEDWKKGAESPEKKPACRKKKTRTVFSRSQVF
QLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAA
QRIVRVPILYHENSAAEGAAAAAAGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRPV
Download sequence
Identical sequences ENSTTRP00000015349 XP_019795501.1.83887 ENSTTRP00000015349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]