SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015502 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015502
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily LysM domain 0.00000000955
Family LysM domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015502   Gene: ENSTTRG00000016356   Transcript: ENSTTRT00000016357
Sequence length 780
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2402:103059:175240:1 gene:ENSTTRG00000016356 transcript:ENSTTRT00000016357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQKPKGTTEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPISPLSPTSSEAELDKTTNPDVVHPKEETLSSAFTGIRPARVVSSTSEEEE
AFTEKFLKINCRYITSGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEV
MSAAMYKEIFDSKIKESLPIEIDQLSGKDFCHLKKMTRSNTDEIDSRIRDAGNDSASTAP
RSTEESLSEDVFTESELSPIREELISSDELRQDKSSGASSESVQTISQSGVECLTVITEA
ASTPDHLKSDSGHTTNEVGTLSLKTDLNNLEMATKEGDQTTDNLQEISGPKEQSTGIKGN
ADQDFLLNENSLHHEEGEKESMPCGEAIEFKHKPIVNKGKQGKEQNQDSETEVEELRKLW
KTHTMQQTKQQRENIQQVSQKEIKHKIATTNIEGSALLKEKRRHRLHKFLCLRVGKPMRK
TFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYFFIQWSPEIYAEDTGEYTREPGFIV
VKKIEESETSEDSTNEAAAREWEXXXXXXXXRRIDALNTEELRTLCRRLQITTREDINSK
QVTPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLK
TLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPQFEVFKWT
GDNMFFIKGDMDSLAFGGGGGEFVLLDDLYRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences ENSTTRP00000015502 ENSTTRP00000015502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]