SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015590 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015590
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.32e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-147
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000589
Family N-terminal PAS domain of Pas kinase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015590   Gene: ENSTTRG00000016446   Transcript: ENSTTRT00000016446
Sequence length 806
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2648:4383:107222:1 gene:ENSTTRG00000016446 transcript:ENSTTRT00000016446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSTQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSILYVSDSITPLLGHL
PSDVTDQNLLRFLPEQEHSEVYKMLSSHMLVTDSPSPEHLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNAPSPSCNGFDSALSRTCRMPLGKEVCFIATVRLATPQFLKE
MCIVDKPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRVER
RQELALEDPLLETVHPSALKHKGSSLEAQQHFNALDVGTSGLNTSHSPSASSRSSHKSSR
TAVSEPTSTPGKLRAEAGTTALPRSAQELPVLGLSQAATMPAPLPAPASCDVTQQLLPQA
ILQSPPAPVTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
MFLQQPDVSLSFCSAQRPGAQQQLQQRSGPGPQPQLVASPQLLGQVASAQVTSQHLLRDS
SVISTQGPKPLRSPQMMQGNSLTPQFSSTSAVLPPALSLTTPASASQEASQGQPSPDFSH
DRQLRLLLSQPIQPMMPGPCDARRPSEVGRPGRQVRYPQSQAACPNPDVHTTTSSASTPV
LLMGLHPHFPTSQPSPLKPAQTQQQPPCFLQVQAPTSLHSDQQDSLRLSTYSQQPGTLGY
PPPAPSRPPRRLSSLSESSGLQQLPR
Download sequence
Identical sequences ENSTTRP00000015590 ENSTTRP00000015590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]