SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015834 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015834
Domain Number 1 Region: 40-110
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000038
Family Heme-binding PAS domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015834   Gene: ENSTTRG00000016701   Transcript: ENSTTRT00000016701
Sequence length 620
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2468:80790:145625:1 gene:ENSTTRG00000016701 transcript:ENSTTRT00000016701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGKRERRVSEASREKSNWIPSRHSYEDLNQMILQSLDGFMIIVSTDGVIIFVTDNISS
LLGHLPDDIMGKNLLSLLPDEEKHEVYQKISVKLPLSSSEKHIDFCCHLKRGGAEHDSSP
AYECVKFILSVKFISNEPVVFFRSFFPSLSGELSARNLSLEDRFCLVGTACVLRIQILMD
LFTVKESGEDVLLAPDSEEEHLPVDHRSVQGQRSSSGMELLHAEPDAPASEGRVNVVMVD
QYGSQESARVIKRKSFTYYDSSTSTLETIPEPPAPLSLPSFEVKTEVEHVEQMDQMGDME
QVDEEKEVDKVDQVPQEDRDTISPVSADVRNQSLHPPPSVIWYVNRREEELMKRFREQLE
ERTQMLRGEIWNQNHALEMLKEQLQIQPSTSRHIHSPEPQPLEPVPKKQCIGPMHRFLPD
CKGARHFCGSCSSYSFRFPEELQQPCDASSQQPQELVQYLPQRRLQEQSQQHNVTVENRV
LQILVPSQPNVSLPLDHICLRMQHITVPVQLEAEQQPSSSYHGENPGGQEGRSHSFLLED
QQGPCLSPLLLAHNPSSEMISSTVIPQCQISSDSNLVMLQIPEDSNQLCQQPEDPLTFTQ
VETWPSSEQASLQDQVTWVQ
Download sequence
Identical sequences ENSTTRP00000015834 ENSTTRP00000015834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]