SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015837 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015837
Domain Number 1 Region: 370-559
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-39
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 133-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-32
Family Voltage-gated potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015837   Gene: ENSTTRG00000016704   Transcript: ENSTTRT00000016704
Sequence length 650
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2468:208438:214187:1 gene:ENSTTRG00000016704 transcript:ENSTTRT00000016704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKANGVKSSLANNHSHHAPPAIKVNGEDDHRTSNRPQSAADDDTSSQLQRLQRRGGFC
RIACLMGVIREWANKNFHEEEPRPDSFLERFCGPELQTVTTQQGDGKGDKDSEGKGSKKK
CELFVLDPAGDWYYRLFVIAMPVLYSWCLLVARACDLQKDYCIVWLVLDYFSDVVYIADL
FIRLRTGFLEQGLLVKDTKMLRDNYIHTLQFKLDVASIIPTDLIYFPVGIHRPELRFNRL
LHFARMFEFFDRTETRTSHHNIFHISNLVLYILVIICWNACIYYAISKSIGFGVDTWVYS
NIIDPEYGYLSRECIYCLYWSTLTLTTIGVTPPPVKDEEYLFVIFDFPIGVLIFATIVGN
VGSMISNMNATRAEFQAKIDAVKHYMQFQKVSKEMEAKVIRWFDYLWTNKKSVDEWEVLK
KLPSKLRAEIAINVHLFTLKKVCIFQDCEAGLLVELVLKLHPQVFSPGDYGGIGKEMYII
KEGKLAVVADDGVTQYALLLAGSCFGEISTLNIKGSKTGNRRTANIRSLGYSDLFCLSKD
DLMEAVTEYPDAKRVLEERGREILMKEGLLDENEVAASIEADVQKKLEQLETNMETLYTR
FPCLLAEYPGAQQKLRQRIMVLETKMKQNNEDDYLSDGMNSPKPAAAEKP
Download sequence
Identical sequences ENSTTRP00000015837 ENSTTRP00000015837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]