SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015999 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000015999
Domain Number - Region: 167-270
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000337
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015999   Gene: ENSTTRG00000016875   Transcript: ENSTTRT00000016875
Sequence length 400
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_865:830520:861401:1 gene:ENSTTRG00000016875 transcript:ENSTTRT00000016875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQHFYHQNHTRVRPSSLFEDVSPLFYETLWKSQRKDTQCQAFVKRVIMSRLFKIIMIST
VSTNAFFMVLWTDYKTRYNLFRLFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLISAMGQTACTVAS
VLVLLFVLMYVFAVLGFCLFGVPESADLKNWGNLALAFFTLFSLATVDGWTDLQQQLDAR
NFTLSRSFTIIFILLASFVFLSMFVGVMIIHTEDSVKKFERELMLERHMTLMEEKHVILK
WQQEEVSKLMQTQKNVDHKSSTELVEKFKKTLRHTDPMVLDDFGTSLPFIDVYLSTLDNQ
DATIYKLQELYYEIVHVLSLMLEDLPQRKQSQSLEKVEEK
Download sequence
Identical sequences ENSTTRP00000015999 ENSTTRP00000015999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]