SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016083 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016083
Domain Number 1 Region: 436-830
Classification Level Classification E-value
Superfamily ALDH-like 1.1e-130
Family ALDH-like 0.00000000839
Further Details:      
 
Domain Number 2 Region: 23-222
Classification Level Classification E-value
Superfamily Formyltransferase 1.16e-49
Family Formyltransferase 0.0000000256
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.24e-25
Family Post formyltransferase domain 0.0000132
Further Details:      
 
Domain Number 4 Region: 345-434
Classification Level Classification E-value
Superfamily ACP-like 0.0000314
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016083   Gene: ENSTTRG00000016966   Transcript: ENSTTRT00000016966
Sequence length 831
Comment pep:known_by_projection scaffold:turTru1:scaffold_112600:269930:316529:1 gene:ENSTTRG00000016966 transcript:ENSTTRT00000016966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWQGNQALRRFSTGQVYFKNKLKVALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKNGTPVFKFPRWRVKGKTIKEVVEAYRSVGAELNVLPFCTQFIPMDVIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAARMPQSEEAATYEGIQKKENAEISWDQSAE
ALHNWIRGHDKVPGAWTEINGQVVTFYGSSLLNSSIPPGEPLEIKGARKPGLVTKSGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEAELVVDYVSKEVNEMTVKMPHQCFINGRFTDADDGKTYDTINPTDGSTICKVSYASLV
DVDKAVAAAKDAFENGEWGRMNARERGILMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGTTIPINQARPNRNLTFTRKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSVSEHPDIRKL
GFTGSTLIGKQIMKSCAMSNLKKVSLELGGKSPLIIFSDCELDKAVRMGMGAVFFNKGEN
CIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGV
KEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQN
Download sequence
Identical sequences ENSTTRP00000016083 ENSTTRP00000016083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]