SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016108 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016108
Domain Number 1 Region: 17-628
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.66e-228
Family Aconitase iron-sulfur domain 2.01e-16
Further Details:      
 
Domain Number 2 Region: 633-885
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.96e-75
Family LeuD-like 0.000000000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016108   Gene: ENSTTRG00000016991   Transcript: ENSTTRT00000016991
Sequence length 892
Comment pep:known_by_projection scaffold:turTru1:scaffold_110830:34791:71196:1 gene:ENSTTRG00000016991 transcript:ENSTTRT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFAHLAEPLDPAQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDQFLVKKNDV
ENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSLAFRNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLMGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIKYLVQTGRDEEKVKHIKKYLQAVGMFRDFSDSAQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVALDHHNDHKTFIYNNS
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEAVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLRDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAAPSDKLYYWNPKSTYIKSPPFFEDLTLDLRPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPTGEILDVFDASERYQQAGLPLIVLAGKEYGSSSRD
AAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPET
LKPRMKVQVKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAKALVSS
Download sequence
Identical sequences ENSTTRP00000016108 ENSTTRP00000016108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]