SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016393 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016393
Domain Number 1 Region: 354-706
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.26e-132
Family Transferrin 0.0000000000338
Further Details:      
 
Domain Number 2 Region: 21-351
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-129
Family Transferrin 0.0000000000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016393   Gene: ENSTTRG00000017296   Transcript: ENSTTRT00000017296
Sequence length 708
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3070:161389:189423:-1 gene:ENSTTRG00000017296 transcript:ENSTTRT00000017296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFFPALLSLGALGLCLAGPTKNVRWCAISLPEWLKCYQWRWRMKSLGTPSVTCVRRTS
RFECIQAIAANKADAVTLDGGLVFEAGLDPYKLRPVAAEVYGTEEQPQTQYYAVAVVKKG
SNFQLNQLQGRKSCHTGFGRSAGWNIPMGTLRPFLNWTGPPEPLQKAVAKFFSASCVPCV
DGKEYPNLCQLCTGTGRNKCACSSQEPYFGYSGAFKCLQDGAGDVAFVKDSTVFENLPAK
ADRDQYELLCPNNTRKPVDAFKECHLAQIPSHAVVARSVDGKEDLIWNLLLKAQEKFGKS
ALQGFQLFGSPPGQKDLLFKDSALGFLRIPSKIDSGLYLGFRYLTALQGLRETAAEVEAR
RARVVWCAVGQEEERKCRQWSLQSNQNVSCATATTTEDCIALVLKGEADALSLDGGYIYT
AGKCGLVPVLAENQKSSKSNSLDCVHRPTEGYLAVAVVKKANAELTWNSLRGKKSCHTAV
DRTAGWNIPMGLIANQTGSCKFDEFFDQSCAPGADPKSSLCALCVGDDWNMNKCVPNSKE
RYYGYTGAFRCLAEDAGDVAFVKDATVLENTNXXXXXXXXXXXXXXDFELLCLDGTVPVT
EAESCYLAVAPNHAVVSRSDKAAHVEEVLLRQQAQFGKNGKHCPDRFCLFQSETKNLLFN
DNTECLAKLGGKTTYEKYLGPEYVTAIANLKKCSTSPFLEACAFLRGQ
Download sequence
Identical sequences ENSTTRP00000016393 ENSTTRP00000016393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]