SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016496 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016496
Domain Number 1 Region: 218-393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000022
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016496   Gene: ENSTTRG00000021432   Transcript: ENSTTRT00000021442
Sequence length 593
Comment pep:novel genescaffold:turTru1:GeneScaffold_2818:62306:79213:1 gene:ENSTTRG00000021432 transcript:ENSTTRT00000021442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASSSDSDSGRAESSEASSKWLDAHYDPMANIHTFSACLQLADLHGDGEYKLVVGDLG
PGGQQPRLKVLKGPTVLSESPLPALPAAAATFFMEQHEPRTPALALASGPCVYVYKNLRP
YFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLEGIREKAEVPLSVQSLRFLQLELS
EMEAFVNQHKSKSIRRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTVLA
KMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYMLRRDSKRPKYCIELSAQPVGLVRVHK
VLVVGSNQDSLHSFTHKGKRLWTVQMPAAILTMNLLEQRSRGLQAVMAGLANGEVRIYRD
KALLSIVRTPDAVTSLCFGRYGREDHTLIMTTRGGGLIIKILKRTAVFVEGGGEAGPPPA
QAMKLNMPRKTRLYVDQTLREREAGTAMHRAFQADLYLLRLRAARAYAQALESSXXXXXX
XXXXXXXXXXXVQGLGPTFKLTLHLQNTSTARPILGLLVCFLYNEGLYALPRAFFKVPLL
VPGLNYPLETFVESLSDKGISDIIKVLVLREGQSAPLLSAHINMPVSEGLAAA
Download sequence
Identical sequences ENSTTRP00000016496 ENSTTRP00000016496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]