SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000057 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000057
Domain Number 1 Region: 79-267
Classification Level Classification E-value
Superfamily L domain-like 7.94e-40
Family Ngr ectodomain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 292-330,359-413
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000349
Family I set domains 0.081
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000057
Domain Number - Region: 571-609
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00472
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000057   Gene: ENSTTRG00000000062   Transcript: ENSTTRT00000000062
Sequence length 632
Comment pep:known_by_projection scaffold:turTru1:scaffold_116369:211166:214504:1 gene:ENSTTRG00000000062 transcript:ENSTTRT00000000062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNRCGKRPAVVLAPRPQVWRRGCSPRAAAESRRAAGSAMVPLRALWLAWALLGVARACP
EPCACVDKYAHQFADCAYKELHEVPEGLPANVTTLSLSANKITVLRRGAFADVTQVTSLW
LAHNEVRTVELGSLAVLSQLKNLDLSHNLISSFPWSDLRNLSALQLLKMNHNRLGSLPRD
ALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCSLVWLQAWAASTRV
SLPEPDSIACASPPALQGVPVHRLPALSCAPPSVHLSVEPPPEAPGSPLRSGLTLMLHCV
AEGHPTPRLQWQLQIPGGTVVLVPPILSGEDDGDGGEDGEEEGDGDGPTQTEAPTPTPAP
AWPAPPATPRFLALTNGSLLVPLLSAKEAGIYTCRAHNELGANSTSVRVAVAAAGPPKHA
PGSGGDPDGQAPTSERKSTAKTRGNSVLPSKPEGKIKSQGLGRVSVLGETQAGPEGDEEA
GEGEEAEDQVSADPVEEQRCGHGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREAR
VQLTPLAARWGPGPGGAAGAGRPGRRPLRLLYLCPAGGGAAVQWSRVEEGVNAYWFRGLR
PGTNYSVCLALAGEPCHVQVVFATKKEFPSLL
Download sequence
Identical sequences ENSTTRP00000000057 ENSTTRP00000000057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]