SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001198 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001198
Domain Number 1 Region: 264-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000563
Family I set domains 0.0027
Further Details:      
 
Domain Number 2 Region: 42-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000102
Family I set domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001198   Gene: ENSTTRG00000001275   Transcript: ENSTTRT00000001277
Sequence length 387
Comment pep:novel genescaffold:turTru1:GeneScaffold_3474:25993:38556:-1 gene:ENSTTRG00000001275 transcript:ENSTTRT00000001277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCGLRHQHGWAMGGTATTPTLTALLCLGLSQGPWIQVQVRVLPKPSIWAPGVMVTKGSPV
TILSPGSLRADVYRLYRERPSGLWRLRPGLQQGQFPLILELKHAGQYQCVYHCRKDRSEW
SDPLPLVGTASLSPRPVAASGGGVSGSSQFAAGTLHLLKEGGADPRRRTSRTHGRGQAVC
PVGPLNSSRGGTRGCYDSQLPAHVWSHPSHPLHRQVTGVYKEPSVSAPGSLVLRGDRLIQ
QPLSPRPDCSGCWAQSHPAVMGSMYRKPSLSAQLGASEPCRENVTLCGSEVWSNPLHLSK
EGSSLLMHLRLQDTANFTLSPVTSAHSGTYTCYSSLSTSPSLRSQPSPLELLLSALGACR
LSPTCTNAMSGGSEVGALPPTEPGPQT
Download sequence
Identical sequences ENSTTRP00000001198 ENSTTRP00000001198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]