SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001375 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001375
Domain Number 1 Region: 32-269
Classification Level Classification E-value
Superfamily L domain-like 1.02e-36
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 279-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000427
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001375   Gene: ENSTTRG00000001459   Transcript: ENSTTRT00000001459
Sequence length 493
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1671:62556:64037:-1 gene:ENSTTRG00000001459 transcript:ENSTTRT00000001459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQCDLRGLWLLLLSLFLLLFEEARAGRPLVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNQLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSELQALEVLLLYNNHIMAVDRCAFDDVVQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLHCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMSSKKLHNVFSLSFLNCSEYKERAWEAHLGDTLTIKCDTKQQGMTKV
WVTPSNERVLDEVANSTVTVSKDGSLHFRRVQVEDGGVYTCYAVGEAFNETLSVELKVYN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDQRVAFLEPAGTGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences ENSTTRP00000001375 ENSTTRP00000001375 XP_004320147.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]